PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_07115-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bHLH
Protein Properties Length: 254aa    MW: 28572.1 Da    PI: 6.5211
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_07115-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH12.40.000293165237
                     HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS- CS
              HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskK 37
                     +  ++erE+r R   N+ f+eL  +l ++ +++++K
  TRIUR3_07115-P1 31 KIHKSEREKRKRGTQNDLFNELGAMLEPD-RQNNGK 65
                     66789*********************996.244443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474595.23E-102998IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.0742979IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.7E-73098IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVPRDMVNAP AERLHDQGSV VNRKCEKVPK KIHKSEREKR KRGTQNDLFN ELGAMLEPDR  60
QNNGKACVLG DTTRILKDLV SQVESLRKEN STLKNESHYV VLERNELRDD NSMLRNEILE  120
LQNKLRMRLQ SNPIWSQDTT TRSAVAVPYP TSGVFPVQHS PHSPVITSTA LSLHPVITEQ  180
CYAAPPRELQ LFPEASSAST EDSELSQDQG ISNSVTRPQA RYPTPAVMSP VNEFPILPRM  240
GEEQQYSSGT SEEV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679530.0AK367953.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562634.11e-129PREDICTED: transcription factor bHLH47-like
TrEMBLM8AG320.0M8AG32_TRIUA; Transcription factor bHLH47
STRINGBRADI1G20560.21e-129(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24813884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47640.33e-29bHLH family protein